PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr4P21390_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GATA
Protein Properties Length: 235aa    MW: 24955.2 Da    PI: 9.6936
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr4P21390_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.86.1e-18164198135
                   GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                            C++C + kTp+WR gp g+ktLCnaCG+++++ +l
  GSMUA_Achr4P21390_001 164 CTHCLSQKTPQWRAGPLGPKTLCNACGVRFKSGRL 198
                            *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.0E-14158212IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.5E-15160222No hitNo description
PROSITE profilePS5011410.963162194IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.0E-13162196IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.52E-13163210No hitNo description
PROSITE patternPS003440164189IPR000679Zinc finger, GATA-type
PfamPF003201.1E-15164198IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MDASKNSSSA ATSLLGDFTP GEGGEDGSLE WLSIYVEDCL SSAATSYTTF DPLPASAPPQ  60
TPNPKPAFKS LAVQAKARTK RRRRITPGNL SIDTFSTFHL TSSDPPLLHQ AHWLAESELI  120
LPKKEEEDKT PTPALGGGGG GGGGGGGGGG EEKLGKEGVH PRRCTHCLSQ KTPQWRAGPL  180
GPKTLCNACG VRFKSGRLLP EYRPAKSPTF VSYKHSNSHK KVMMMRTALL SSNPN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17984KRRRRI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009398524.11e-173PREDICTED: GATA transcription factor 2-like
TrEMBLM0SQV21e-173M0SQV2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P21390_0011e-172(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59623656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.11e-35GATA transcription factor 2